PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0428s0090.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 285aa    MW: 31580.6 Da    PI: 6.0269
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0428s0090.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.78.2e-4371061100
                  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 
                             +CaaCk+lrrkC+++Cv+apyfp +qp+kfa vhk+FGasnv kll++l+  +reda++sl+yeAe r+rdPvyG+vg+i+ lqq+l
  SapurV1A.0428s0090.1.p   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFASVHKVFGASNVAKLLNELSAAQREDAVNSLAYEAEERLRDPVYGCVGLISILQQRL 93 
                             7************************************************************************************** PP

                  DUF260  88 eqlkaelallkee 100
                             +ql+++l ++k+e
  SapurV1A.0428s0090.1.p  94 KQLQNDLYSAKKE 106
                             *******999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.6536107IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-427104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFASVH KVFGASNVAK LLNELSAAQR  60
EDAVNSLAYE AEERLRDPVY GCVGLISILQ QRLKQLQNDL YSAKKELVNY IEGQAMLPML  120
MQPQHLGNSS FSNGMPMMGI PTAGQMGMRA DTHQHHQVNP QQIFEAQQLA AVVAARDQQE  180
MLRAYEQQQH TQAQQEIVRF HGGFEPANSV SAAGFNHMNP AAAMSPSLAL GTFDNTFQIQ  240
PQEEPQPNQL QEELLLQPQS QQPQQIFQHP KSETEEGRSV GPSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002307250.21e-150LOB domain protein 28
RefseqXP_002310159.21e-150hypothetical protein POPTR_0007s11460g
SwissprotQ9FKZ31e-82LBD36_ARATH; LOB domain-containing protein 36
TrEMBLB9H6D51e-150B9H6D5_POPTR; LOB domain protein 28
TrEMBLB9HE741e-150B9HE74_POPTR; Uncharacterized protein
STRINGPOPTR_0005s14150.11e-150(Populus trichocarpa)
STRINGPOPTR_0007s11460.11e-150(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-80ASYMMETRIC LEAVES 2-like 1